Home » Shop » LL-37 (5mg) Spray

LL-37 (5mg) Spray

£29.99 inc. VAT

In stock

**For bulk orders (10 or over), please email us.

LL-37 (5mg) — Research Compound

LL-37 is a multifunctional antimicrobial peptide belonging to the cathelicidin family, primarily expressed by immune cells and epithelial tissues. Beyond its direct interaction with bacterial cell membranes, LL-37 is studied for its role in wound healing, angiogenesis, and immune cell recruitment. Research focuses on its ability to modulate the inflammatory response and its potential to act as a signalling molecule in structural tissue repair pathways.

Findings from early-stage clinical trials have reported:

  • Accelerated rates of re-epithelialisation in chronic wound models observed in experimental studies
  • Broad-spectrum antimicrobial activity against gram-positive and gram-negative bacteria reported in-vitro
  • Increased recruitment of leukocytes and mesenchymal stem cells to injury sites noted in-vivo
  • Observed modulation of pro-inflammatory cytokine levels reported in experimental skin research

Researchers study LL-37 to investigate its potential in overcoming antibiotic resistance and its utility in regenerative medicine. By examining its interaction with Formyl Peptide Receptor 2 (FPR2), it serves as a specialised tool for understanding how innate immunity influences structural tissue recovery. This makes it a significant compound for research into complex dermal recovery and the biological mechanisms of the first-line immune defence.

Available Formats:
This compound is available in a 9ml premixed spray bottle, providing a stable solution for precise administration in research settings.

 

Used solely for in vitro experiments and cannot be:

  • Used in clinical trials involving humans
  • Administered to humans as part of an experiment or investigation
  • Supplied to another party for human investigational use

Catalogue: RP-LL37-01
CAS: 23135-12-6
Formula: C205H340N60O53
Molecular Weight: 4493.28 g/mol
Sequence: [LL-37, 37 aa]

Related Products