Home » Shop » LL-37 — 5mg Research Compound

LL-37 — 5mg Research Compound

£38.99 inc. VAT

In stock

Format

  • The Wolverine Stack (BPC157/TB500 Blend - 5/5mg)

    Format *

  • Shipping Upgrade *

  • *

    ⚠️ COLD-CHAIN LOGISTICS: We utilise specialized Cold-Chain Logistics for these pre-mixed solutions; therefore, Express Shipping is mandatory for Cartridges and Pen systems to ensure maximum product stability and integrity.
  • *

    Reusable pens are temporarily out of stock.

Product total

Options total

Grand total

**For bulk orders (10 or over), please email us.

LL-37 (5mg) — Research Compound

LL-37 is a multifunctional antimicrobial peptide belonging to the cathelicidin family, primarily expressed by immune cells and epithelial tissues. Beyond its direct interaction with bacterial cell membranes, LL-37 is studied for its role in wound healing, angiogenesis, and immune cell recruitment. Research focuses on its ability to modulate the inflammatory response and its potential to act as a signalling molecule in structural tissue repair pathways.

Findings from early-stage clinical trials have reported:

  • Accelerated rates of re-epithelialisation in chronic wound models observed in experimental studies
  • Broad-spectrum antimicrobial activity against gram-positive and gram-negative bacteria reported in-vitro
  • Increased recruitment of leukocytes and mesenchymal stem cells to injury sites noted in-vivo
  • Observed modulation of pro-inflammatory cytokine levels reported in experimental skin research

Researchers study LL-37 to investigate its potential in overcoming antibiotic resistance and its utility in regenerative medicine. By examining its interaction with Formyl Peptide Receptor 2 (FPR2), it serves as a specialised tool for understanding how innate immunity influences structural tissue recovery. This makes it a significant compound for research into complex dermal recovery and the biological mechanisms of the first-line immune defence.

Available Formats:
This compound is available as a vial of lyophilised powder, or can be ordered in a disposable pen, a reusable pen, or a cartridge for an existing reusable pen system.

Used solely for in vitro experiments and cannot be:

  • Used in clinical trials involving humans
  • Administered to humans as part of an experiment or investigation
  • Supplied to another party for human investigational use
IDENTIFICATION
Product Name LL-37 5 mg
Catalogue Number RP-LL37-01
CAS Number 23135-12-6
Molecular Weight (g/mol) 4493.28 g/mol
Molecular Formula C205H340N60O53
Peptide Sequence [LL-37, 37 aa]
PHYSICAL AND CHEMICAL PROPERTIES
Active Ingredient LL-37
Appearance White to off-white lyophilised powder
Melting Point Not applicable (decomposes before melting)
ANALYTICAL AND QUALITY CONTROL
Mass Spectrum Conforms to specification
Structural Confirmation Consistent with theoretical structure / sequence
RESEARCH USE AND SAFETY
Caution Handle using appropriate PPE and in compliance with relevant laboratory safety standards.
Intended Use For laboratory research use only. Not for human or veterinary use.
Hazard Classification Not classified as hazardous under GHS for research quantities
STORAGE, HANDLING AND STABILITY
Storage Temperature, Opened -20 °C, minimise freeze–thaw cycles
Storage Temperature, Unopened -20 °C recommended for long-term storage
Shelf Life 2 years unopened under recommended conditions
Reconstitution Stability Stable for up to 28 days at 2–8 °C in aqueous solution under sterile conditions

Related Products