Home » Shop » LL-37 — 5mg Research Compound

LL-37 — 5mg Research Compound

£38.99 inc. VAT

In stock

Format

  • The Wolverine Stack (BPC157/TB500 Blend - 5/5mg)

    Format *

  • Important Shipping Notice
    Due to the temperature-sensitive nature of pens and cartridges, Express Shipping is applied as the standard minimum to minimise transit time. However, Express delivery does not include temperature-controlled packaging.

    During warmer periods, we strongly recommend upgrading to Cold-Chain Delivery at checkout to protect product integrity.

    Standard Express delivery is selected at the buyer's risk, and we are unable to process refunds or replacements for temperature-related exposure or degradation in transit.
    *

  • We recommend our cold chain logistics upgrade *

  • *

    ⚠️ COLD-CHAIN LOGISTICS: We utilise specialized Cold-Chain Logistics for these pre-mixed solutions; therefore, Express Shipping is mandatory for Cartridges and Pen systems to ensure maximum product stability and integrity.
  • *

    Reusable pens are temporarily out of stock.

Product total

Options total

Grand total

**For bulk orders (10 or over), please email us.

LL-37 (5mg) — Research Compound

LL-37 is a multifunctional antimicrobial peptide belonging to the cathelicidin family, primarily expressed by immune cells and epithelial tissues. Beyond its direct interaction with bacterial cell membranes, LL-37 is studied for its role in wound healing, angiogenesis, and immune cell recruitment. Research focuses on its ability to modulate the inflammatory response and its potential to act as a signalling molecule in structural tissue repair pathways.

Findings from early-stage clinical trials have reported:

  • Accelerated rates of re-epithelialisation in chronic wound models observed in experimental studies
  • Broad-spectrum antimicrobial activity against gram-positive and gram-negative bacteria reported in-vitro
  • Increased recruitment of leukocytes and mesenchymal stem cells to injury sites noted in-vivo
  • Observed modulation of pro-inflammatory cytokine levels reported in experimental skin research

Researchers study LL-37 to investigate its potential in overcoming antibiotic resistance and its utility in regenerative medicine. By examining its interaction with Formyl Peptide Receptor 2 (FPR2), it serves as a specialised tool for understanding how innate immunity influences structural tissue recovery. This makes it a significant compound for research into complex dermal recovery and the biological mechanisms of the first-line immune defence.

Available Formats:
This compound is available as a vial of lyophilised powder, or can be ordered in a disposable pen, a reusable pen, or a cartridge for an existing reusable pen system.

Used solely for in vitro experiments and cannot be:

  • Used in clinical trials involving humans
  • Administered to humans as part of an experiment or investigation
  • Supplied to another party for human investigational use

References

The Potential of Human Peptide LL-37 as an Antimicrobial and Immunomodulatory Agent
This review summarises LL-37 research in antimicrobial resistance, innate immunity, and host defence mechanisms.
Source Link: Available here

LL-37: Structures, Antimicrobial Activity, and Influence on Human Disease
This comprehensive review explores LL-37 structure, biological activity, immune signalling, and antimicrobial research applications.
Source Link: Available here

Immunomodulatory Role of the Antimicrobial LL-37 Peptide
This paper examines LL-37’s role in innate immune regulation, inflammatory signalling, and autoimmune disease research.
Source Link: Available here

Certificate of Analysis (COA): Available here

IDENTIFICATION
Product Name LL-37 5 mg
Catalogue Number RP-LL37-01
CAS Number 23135-12-6
Molecular Weight (g/mol) 4493.28 g/mol
Molecular Formula C205H340N60O53
Peptide Sequence [LL-37, 37 aa]
PHYSICAL AND CHEMICAL PROPERTIES
Active Ingredient LL-37
Appearance White to off-white lyophilised powder
Melting Point Not applicable (decomposes before melting)
ANALYTICAL AND QUALITY CONTROL
Mass Spectrum Conforms to specification
Structural Confirmation Consistent with theoretical structure / sequence
RESEARCH USE AND SAFETY
Caution Handle using appropriate PPE and in compliance with relevant laboratory safety standards.
Intended Use For laboratory research use only. Not for human or veterinary use.
Hazard Classification Not classified as hazardous under GHS for research quantities
STORAGE, HANDLING AND STABILITY
Storage Temperature, Opened -20 °C, minimise freeze–thaw cycles
Storage Temperature, Unopened -20 °C recommended for long-term storage
Shelf Life 2 years unopened under recommended conditions
Reconstitution Stability Stable for up to 28 days at 2–8 °C in aqueous solution under sterile conditions

Certificate of Analysis – LL-37 (99% Purity Verified)

COMPOUND IDENTIFICATION
Product Name LL-37 (10mg)
Batch / Reference ID LL100708
Sample Form White powder in glass vial
ANALYTICAL RESULTS
Chemical Purity 99% (Verified)
Measured Content 4,96mg (± 0,05mg)
Test Method HPLC (High-Performance Liquid Chromatography)
LABORATORY TESTING INFORMATION
Analysis Period 21 Aug 2026 – 27 Aug 2026
Laboratory Order # 100017338
QUALITY ASSURANCE
Quality Testing Standards All River Peptides products undergo batch-level laboratory analysis to verify compound identity and confirm purity levels.
Learn more on our Quality Testing & Purity Verification page.