LL-37 — 5mg Research Compound
£38.99 inc. VAT
In stock
**For bulk orders (10 or over), please email us.
LL-37 (5mg) — Research Compound
LL-37 is a multifunctional antimicrobial peptide belonging to the cathelicidin family, primarily expressed by immune cells and epithelial tissues. Beyond its direct interaction with bacterial cell membranes, LL-37 is studied for its role in wound healing, angiogenesis, and immune cell recruitment. Research focuses on its ability to modulate the inflammatory response and its potential to act as a signalling molecule in structural tissue repair pathways.
Findings from early-stage clinical trials have reported:
- Accelerated rates of re-epithelialisation in chronic wound models observed in experimental studies
- Broad-spectrum antimicrobial activity against gram-positive and gram-negative bacteria reported in-vitro
- Increased recruitment of leukocytes and mesenchymal stem cells to injury sites noted in-vivo
- Observed modulation of pro-inflammatory cytokine levels reported in experimental skin research
Researchers study LL-37 to investigate its potential in overcoming antibiotic resistance and its utility in regenerative medicine. By examining its interaction with Formyl Peptide Receptor 2 (FPR2), it serves as a specialised tool for understanding how innate immunity influences structural tissue recovery. This makes it a significant compound for research into complex dermal recovery and the biological mechanisms of the first-line immune defence.
Available Formats:
This compound is available as a vial of lyophilised powder, or can be ordered in a disposable pen, a reusable pen, or a cartridge for an existing reusable pen system.
Used solely for in vitro experiments and cannot be:
- Used in clinical trials involving humans
- Administered to humans as part of an experiment or investigation
- Supplied to another party for human investigational use
| IDENTIFICATION | |
| Product Name | LL-37 5 mg |
| Catalogue Number | RP-LL37-01 |
| CAS Number | 23135-12-6 |
| Molecular Weight (g/mol) | 4493.28 g/mol |
| Molecular Formula | C205H340N60O53 |
| Peptide Sequence | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| PHYSICAL AND CHEMICAL PROPERTIES | |
| Active Ingredient | LL-37 |
| Appearance | White to off-white lyophilised powder |
| Melting Point | Not applicable (decomposes before melting) |
| ANALYTICAL AND QUALITY CONTROL | |
| Mass Spectrum | Conforms to specification |
| Structural Confirmation | Consistent with theoretical structure / sequence |
| RESEARCH USE AND SAFETY | |
| Caution | Handle using appropriate PPE and in compliance with relevant laboratory safety standards. |
| Intended Use | For laboratory research use only. Not for human or veterinary use. |
| Hazard Classification | Not classified as hazardous under GHS for research quantities |
| STORAGE, HANDLING AND STABILITY | |
| Storage Temperature, Opened | -20 °C, minimise freeze–thaw cycles |
| Storage Temperature, Unopened | -20 °C recommended for long-term storage |
| Shelf Life | 2 years unopened under recommended conditions |
| Reconstitution Stability | Stable for up to 28 days at 2–8 °C in aqueous solution under sterile conditions |


